PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_03878_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Dof
Protein Properties Length: 233aa    MW: 25936.2 Da    PI: 9.7815
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_03878_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.62e-364198259
                      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                                +++ lkcprCds ntkfCyynny+ sqPr+fCkaC+r+WtkGG+lrnvPvGggr++++
  Cotton_A_03878_BGI-A2_v1.0 41 HQQPLKCPRCDSLNTKFCYYNNYNKSQPRHFCKACKRHWTKGGTLRNVPVGGGRKNKR 98
                                7899***********************************************9976554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-234098IPR003851Zinc finger, Dof-type
PfamPF027017.1E-324397IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.414599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGLSSKQVSS DGGHGWSQSL LQAQTLPKAS IIKKRHTQNQ HQQPLKCPRC DSLNTKFCYY  60
NNYNKSQPRH FCKACKRHWT KGGTLRNVPV GGGRKNKRLK PGIKAVSTAI KTSTASSDNS  120
NRLLLDSLMA IQWQQQHPFP PLLDCNNMLM GSSSSLLLPQ TQGQEFPFSS SSSSSISPSI  180
YNYTGEANSS RSQTWQVPSA SMDMANYWNL DDIDELVSTD LNNIPWVDSE IKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025697.15e-72Dof-type zinc finger DNA-binding family protein, putative isoform 1
RefseqXP_012447454.19e-73PREDICTED: dof zinc finger protein PBF-like
TrEMBLA0A061GMJ25e-72A0A061GMJ2_THECC; Dof-type zinc finger DNA-binding family protein, putative isoform 1
TrEMBLA0A0D2TRD41e-72A0A0D2TRD4_G
STRINGPOPTR_0011s04730.15e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-31OBF binding protein 4